PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_39850
Common NameKK1_037445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family BBR-BPC
Protein Properties Length: 255aa    MW: 28392.7 Da    PI: 10.5233
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_39850genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind44.94.5e-14191191
      GAGA_bind  1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllalllv 87
                   md d+  + rn+gyyepa  +k++lglqlmss++e+     r++ + ls++++a+++rd          ++ +rd+++++       +++k+++++++
  C.cajan_39850  1 MDGDNGLNiRNWGYYEPA--IKSHLGLQLMSSMPEKPLIGgRNAAV-LSGTNGAFHHRDigmhqatypTEY-MRDAWISS-------QRDKYMNMIPT 87
                   888888888********9..**************988766355555.9***********999999998888.99999999.......77888999888 PP

      GAGA_bind 88 ensl 91
                   +++ 
  C.cajan_39850 88 NHNY 91
                   8874 PP

2GAGA_bind2861.6e-8790255134301
      GAGA_bind 134 alpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGG 229
                    ++ +eea+ ++k + ++kkrq +k+pk++kakk+k+ ++++k++++++   +r++ +kk++++v+ng+++D+s++P+PvCsCtGa++qCY+WG+GG
  C.cajan_39850  90 NYGVEEAPVVEKPNGTRKKRQGPKVPKSPKAKKPKRGPRTPKDENTPSV--QRARVPKKTTEIVINGIDMDISSIPIPVCSCTGAPQQCYRWGSGG 183
                    567888999999999*********************7777755555555..79******************************************* PP

      GAGA_bind 230 WqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                    WqSaCCtt +S+yPLP+stkrrgaRiagrKmS gafkk+LekLaaeGy++snp+DL+++WAkHGtnkfvtir
  C.cajan_39850 184 WQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGYNFSNPIDLRTYWAKHGTNKFVTIR 255
                    ***********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.5E-16194IPR010409GAGA-binding transcriptional activator
SMARTSM012267.3E-1561255IPR010409GAGA-binding transcriptional activator
PfamPF062172.1E-8793255IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDGDNGLNIR NWGYYEPAIK SHLGLQLMSS MPEKPLIGGR NAAVLSGTNG AFHHRDIGMH  60
QATYPTEYMR DAWISSQRDK YMNMIPTNHN YGVEEAPVVE KPNGTRKKRQ GPKVPKSPKA  120
KKPKRGPRTP KDENTPSVQR ARVPKKTTEI VINGIDMDIS SIPIPVCSCT GAPQQCYRWG  180
SGGWQSACCT TGMSIYPLPM STKRRGARIA GRKMSIGAFK KVLEKLAAEG YNFSNPIDLR  240
TYWAKHGTNK FVTIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0984550.0BT098455.1 Soybean clone JCVI-FLGm-12B13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534122.11e-171PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_003534123.11e-171PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD01e-85BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A151RFM50.0A0A151RFM5_CAJCA; Uncharacterized protein
STRINGGLYMA09G30040.41e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-85basic pentacysteine 2